PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000629440
Common NameMYB6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 313aa    MW: 33740.9 Da    PI: 7.9207
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000629440genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l  +v+++G+++W++I++ ++ gR++k+c++rw + 
    MDP0000629440 12 KGPWSPEEDDSLQXLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding55.21.6e-1766108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000629440  66 AFTPEEDDMIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.882762IPR017930Myb domain
SuperFamilySSF466893.74E-329105IPR009057Homeodomain-like
SMARTSM007171.1E-151160IPR001005SANT/Myb domain
PfamPF002491.9E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-251365IPR009057Homeodomain-like
CDDcd001673.40E-151456No hitNo description
SMARTSM007174.3E-1563111IPR001005SANT/Myb domain
PROSITE profilePS5129421.13364113IPR017930Myb domain
PfamPF002493.3E-1566108IPR001005SANT/Myb domain
CDDcd001671.99E-1266109No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2366112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MAVSRKDMDR IKGPWSPEED DSLQXLVQKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRAFTPE EDDMIIRAHA RFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSDGGGVD  120
LNGGYDGHFL RDHEQPPLKR SVSAGSGVPV STGLYMSPGS PSGSDASDSS AQVMSLSDCH  180
VYRPLARTGG VLPPAETTSS SNNNSSNSEK NDPPTSLSLS LPGVDSEEVS NQVAXVTEST  240
QAPAPAPVST TSVAVQNIPV ELLAVMQGMI RKEVRNYMAG LEQSGVCFQQ AAXGNEGFWN  300
VGVKRIGFSR IE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-41111133105MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-41111133105C-Myb DNA-Binding Domain
1msf_C5e-41111133105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.136300.0bud| flower| fruit| leaf| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744610.0DQ074461.1 Malus x domestica MYB6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008338349.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-92MYB44_ARATH; Transcription factor MYB44
TrEMBLQ2LMF10.0Q2LMF1_MALDO; MYB domain class transcription factor
STRINGPOPTR_0007s10490.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-88myb domain protein 73
Publications ? help Back to Top
  1. Hellens RP, et al.
    Transient expression vectors for functional genomics, quantification of promoter activity and RNA silencing in plants.
    Plant Methods, 2005. 1: p. 13
    [PMID:16359558]